SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KZG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KZG8
Domain Number 1 Region: 378-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-51
Family SPRY domain 0.00085
Further Details:      
 
Domain Number 2 Region: 11-82
Classification Level Classification E-value
Superfamily RING/U-box 2.21e-19
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 143-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000168
Family B-box zinc-binding domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3KZG8
Sequence length 558
Comment (tr|I3KZG8|I3KZG8_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000026515} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100692032 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MAELEFQNDETKLCCSICLDILKDPTTIPCGHNYCMNCIKAHWDAEDTKQAHSCPQCRQT
FTPRPFLMKNTMLAELVEELKRIRLQDAPDDDHCYAGPEDVACDVCTGRKMKAFKSCLCC
LASYCEKHLQPHYDVVPLKKHKLVEPSKKLQENICSRHDEVMKMFCCTDQQSICYLCSVD
EHKGHDTVSAAAERTERQRELEVSRQNIQQRIQDREKDVKLLQQEVEAINQSADQTVEHS
EKIFTELIHLIQNRSSDVKQQIRSQQETEVSRVKELEEKLEQEITELKRKDAELKQLSHT
EDHIQFLHNYPSLSALSESTDSSSINIRPLRYFEDVTAAVSEVRDKLQDILREEWTNISL
TVTEVDVSLSDPPEPKTRAEFLKYSCEITLDPNTAHKQLLLSEGNRKATAVKQQQSYSDH
SDRFAIMWQVLSRESLTGRCYWEVEWRVNGAYVAVAYKNISRAGSGNECRFGRNEKSWAL
DCFKNSYTFWYNNIQTRVSGPRSSRVGVYLDHRAGILSFYSVSETMTLLHRVQTTFTQPL
CAGLWLHCFGNTAKFCKL
Download sequence
Identical sequences I3KZG8
ENSONIP00000026515 ENSONIP00000026515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]