SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3RJF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3RJF7
Domain Number 1 Region: 1-176
Classification Level Classification E-value
Superfamily P40 nucleoprotein 1.03e-70
Family P40 nucleoprotein 0.0000000498
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3RJF7
Sequence length 179
Comment (tr|I3RJF7|I3RJF7_9MONO) Nucleoprotein {ECO:0000313|EMBL:AFK24397.1} OX=1715293 OS=Aquatic bird bornavirus 1. GN=N OC=Mononegavirales; Bornaviridae; Bornavirus.
Sequence
AIDWINGQPWAGSLVLALITTDFESPGKEFMDQIKLVASYAQMTTYTTIKEYLGECMDAT
LIIPAVAYEIKEFLKVSSELKSEHGDLFKYLGAIRHQDAIKLAPRNFPNLASAAFYWSKK
ENPTMSGYRASTIQPGSSVKEAQLARYRRREVTRGEDGAHLSDEIAEIMRMIGVTGLQP
Download sequence
Identical sequences I3RJF7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]