SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3SJL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I3SJL8
Domain Number - Region: 70-99
Classification Level Classification E-value
Superfamily BAH domain 0.017
Family BAH domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3SJL8
Sequence length 153
Comment (tr|I3SJL8|I3SJL8_LOTJA) Uncharacterized protein {ECO:0000313|EMBL:AFK40460.1} OX=34305 OS=Lotus japonicus (Lotus corniculatus var. japonicus). GN= OC=Loteae; Lotus.
Sequence
MACKVQKRISLRRKLHILRVLINSNHASRTSTAKSTLLQVYKLKFALETIKREYENLLAT
RRECTSRLNHVKENKDVKVEKISDGTFVVRITCEEKGSDKLVAILEAFEEMSMNVEQARV
SCENGFSLEAIAVAEDKTIEVRDVTEALLKAIG
Download sequence
Identical sequences I3SJL8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]