SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I4GPH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4GPH7
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily XisI-like 7.72e-27
Family XisI-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I4GPH7
Sequence length 102
Comment (tr|I4GPH7|I4GPH7_MICAE) Genome sequencing data, contig C299 {ECO:0000313|EMBL:CCI09838.1} KW=Complete proteome OX=213618 OS=Microcystis aeruginosa PCC 7941. GN=MICAD_900013 OC=Microcystaceae; Microcystis.
Sequence
MRMDNTVNYADILTQVIRKESAMQPRLQTLKITPVCDPESGNFLIIMTGWEKEAWINTIL
FHARLLKNKIVIEDDNLEEGLTTTLIQAGIPPEDIITGLSLE
Download sequence
Identical sequences I4GPH7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]