SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I4I211 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4I211
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily XisI-like 4.71e-48
Family XisI-like 0.0000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I4I211
Sequence length 111
Comment (tr|I4I211|I4I211_MICAE) Genome sequencing data, contig C319 {ECO:0000313|EMBL:CCI28335.1} KW=Complete proteome OX=1160284 OS=Microcystis aeruginosa PCC 9808. GN=MICAG_460014 OC=Microcystaceae; Microcystis.
Sequence
MEKLEQYRHYVKQVITEYSQIGSSKDPIEQQLIFDTVGDHYQLMYVGWKNRRRYHGCVLH
LDIKKGKIWIQHDGTEVGIANELVNLGVPKEDIVLAFHEPLVREYTGFAVG
Download sequence
Identical sequences A0A1X9LB04 A0A2H6BUN9 A0A2H6L1Z5 A8YJ72 B0JV91 I4FIJ7 I4FMF8 I4FZS5 I4GM09 I4H159 I4I211 I4IW82 L8NNG1 S3J396
WP_002748301.1.13945 WP_002748301.1.24258 WP_002748301.1.4043 WP_002748301.1.43950 WP_002748301.1.5315 WP_002748301.1.62741 WP_002748301.1.6707 WP_002748301.1.7764 WP_002748301.1.86711 WP_002748301.1.88161 WP_002748301.1.92877 WP_002748301.1.98808 449447.MAE_16030 gi|166364344|ref|YP_001656617.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]