SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I4IGL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4IGL7
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily XisI-like 1.31e-44
Family XisI-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I4IGL7
Sequence length 111
Comment (tr|I4IGL7|I4IGL7_9CHRO) FdxN element excision controlling factor protein like {ECO:0000313|EMBL:CCI33441.1} KW=Complete proteome OX=1160279 OS=Microcystis sp. T1-4. GN=MICAI_340007 OC=Microcystaceae; Microcystis.
Sequence
MDKLNHYRKIIHQILVPYSQIIYNNADIQNRLAFDPQNDQYLVISEGWQQNQRYHDCLIH
LEIINEKIWVQCDNTEDGITKELLSAGIAKEDIVLGFHEPKIRQYTGFAVA
Download sequence
Identical sequences A0A0F6RK03 A0A139GIU6 A0A1V4C057 I4FTI8 I4H8V2 I4IGL7 I4IVG8
WP_002762148.1.20667 WP_002762148.1.24258 WP_002762148.1.39664 WP_002762148.1.43950 WP_002762148.1.52201 WP_002762148.1.77316 WP_002762148.1.79847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]