SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I6QI42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I6QI42
Domain Number - Region: 16-74
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.00353
Family Major surface antigen p30, SAG1 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I6QI42
Sequence length 92
Comment (tr|I6QI42|I6QI42_9APIC) Surface antigen 4 {ECO:0000313|EMBL:AFK82452.1} OX=1194633 OS=Sarcocystis sp. RMS-2012. GN= OC=unclassified Sarcocystis.
Sequence
GNAAALQPQQSTKIFDQNCQQEVDLETVTPGATCQRGAGGMVTVTFPRLPTQNRKLCFVC
TRGQENCKVIIDVAGDPAGGAAVGITARTASA
Download sequence
Identical sequences I6QI42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]