SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I6QMM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6QMM6
Domain Number 1 Region: 132-268
Classification Level Classification E-value
Superfamily ISP domain 2.52e-39
Family Rieske iron-sulfur protein (ISP) 0.00000285
Further Details:      
 
Domain Number 2 Region: 75-143
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 1.96e-21
Family ISP transmembrane anchor 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I6QMM6
Sequence length 270
Comment (tr|I6QMM6|I6QMM6_9HEMI) Cytochrome b-c1 complex subunit Rieske, mitochondrial {ECO:0000256|RuleBase:RU004494} OX=236421 OS=Anasa tristis (squash bug). GN= OC=Panheteroptera; Pentatomomorpha; Coreoidea; Coreidae; Coreinae; Anasa.
Sequence
MINAVSRSGNLSPYLRGVSAVGSPKSITLSIPSSSTIVVDKKSEVFTSYSLSRILPTRDV
KILSGPLASTQIRFAHTDLKVPDFSPYRRSAVQSPTADSQSSEESRKTFSYVIVGAGGVA
GAYAAKTLVTQYITSMSASADVLAMAKIEVKLSDIPEGKSMTFKWRGKPLFIRHRTGEEI
SKERQTPVSELRDPERDEDRVQKAEWLVLIGVCTHLGCVPIANAGDYGGYYCPCHGSHYD
NSGRIRKGPAPLNLEVPPYEFMDESTLVVG
Download sequence
Identical sequences I6QMM6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]