SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I6UY25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6UY25
Domain Number 1 Region: 99-178
Classification Level Classification E-value
Superfamily T-antigen specific domain-like 3.66e-22
Family T-antigen specific domain-like 0.00058
Further Details:      
 
Domain Number 2 Region: 1-65
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000000000157
Family Chaperone J-domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I6UY25
Sequence length 206
Comment (tr|I6UY25|I6UY25_9POLY) Small t antigen {ECO:0000313|EMBL:AFN02463.1, ECO:0000313|EMBL:AGL07634.1} KW=Complete proteome OX=1203539 OS=MW polyomavirus. GN= OC=Viruses; dsDNA viruses, no RNA stage; Polyomaviridae.
Sequence
MDRVLSRDEVKELMALLSLNTAAWGNIPLMQYKYRQTCLKLHPDKGGDGEKMKRLNELFS
KMYTTIEKLRREGEVYFPAKVGYFIDDVVTLGDVLGPSFEEKIIYIWPLCASDLLRHKCG
CVCCLLKKQHRNDKLAKQKQCLVWGECFCYKCFLLWFGQEFGYTSFFWWKHIMHNTEFDL
LRLLGELILWVSSFSFILGKSHLWDS
Download sequence
Identical sequences I6UY25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]