SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I7BPY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7BPY2
Domain Number 1 Region: 52-179
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 2.09e-37
Family Major surface antigen p30, SAG1 0.000000181
Further Details:      
 
Domain Number 2 Region: 181-301
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 6.02e-34
Family Major surface antigen p30, SAG1 0.000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I7BPY2
Sequence length 336
Comment (tr|I7BPY2|I7BPY2_TOXGO) Surface antigen {ECO:0000313|EMBL:AFO54880.1} OX=5811 OS=Toxoplasma gondii. GN=SAG1 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MSVSLHHFIISSGFLTSMFPKAVRRAVTAGVFAAPTLMSFLRCGVMASDPPLVANQVVTC
PDKKSTAAVILTPTENHFTLKCPKTALTEPPTLAYSPNRQICPAGTTSSCTSKAVTLSSL
IPEAEDSWWTGDSASLDTAGIKLTVPIEKFPVTTQTFVVGCIKGDDAQSCMVTVTVQARA
SSVVNNVARCSYGADSTLGPVKLSAEGPTTMTLVCGKDGVKVPQDNNQYCSGTTLTGCNE
KSFKDILPKLTENPWQGNASSDKGATLTINKEAFPAESKSVIIGCTGGSPEKHHCTVKLE
FAGAAGSAKSAAGTASHVSIFAMVIGLIGSIAACVA
Download sequence
Identical sequences I7BPY2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]