SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I9P848 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I9P848
Domain Number - Region: 27-77
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0804
Family Fibrinogen coiled-coil and central regions 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I9P848
Sequence length 88
Comment (tr|I9P848|I9P848_HELPX) Uncharacterized protein {ECO:0000313|EMBL:EJB18481.1} KW=Complete proteome OX=992017 OS=Helicobacter pylori CPY3281. GN=HPCPY3281_0951 OC=Helicobacteraceae; Helicobacter.
Sequence
MKKIVVSWCVALAFLSADSAQVNKTITNADLIKEIRDLKKIINAQNTEINNLRRVQEVLS
GQLGDMRKDILSTRDYCISLRPYIYNWR
Download sequence
Identical sequences I9P848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]