SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I9PNQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I9PNQ1
Domain Number - Region: 41-110
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.0785
Family Staphylocoagulase 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I9PNQ1
Sequence length 195
Comment (tr|I9PNQ1|I9PNQ1_HELPX) Flagellar motility secretory protein {ECO:0000313|EMBL:EJB22734.1} KW=Complete proteome OX=992020 OS=Helicobacter pylori CPY6271. GN=HPCPY6271_1302 OC=Helicobacteraceae; Helicobacter.
Sequence
MNLRLAGASVLTACVFSGCFFLKMFDKKLSSNDWHIQKVEMNHQVYDIETMLADSAFREH
EEEQDSSLNTALPEDKAALEAKEQEQKEKRKHWYELFKKRPKPKSSMGEFVFDQKENRIY
GKGYCNRYFASYVWQGDRHIGIEDSGISRKVCKDEHLMAFELEFMENFKGNFTVTKGKDT
LILDNQKMKIYLKTP
Download sequence
Identical sequences A0A0K9MPH1 I9PNQ1 T5CZ65 U4R834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]