SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I9X470 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I9X470
Domain Number - Region: 112-156
Classification Level Classification E-value
Superfamily IpaD-like 0.0811
Family IpaD-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I9X470
Sequence length 161
Comment (tr|I9X470|I9X470_HELPX) Flagellar basal-body rod protein FlgC {ECO:0000256|RuleBase:RU362062} KW=Complete proteome OX=992081 OS=Helicobacter pylori Hp P-16. GN=HPHPP16_1501 OC=Helicobacteraceae; Helicobacter.
Sequence
MFLSSFDISGYGLSAQRLRANLISSNIANANTTRTSEGGPYRRQEAVFRAFDFNEILNQK
IAQNNQIIPYEDPLDEGDDNPLIPITSVVVAKIVRDDSEPLMKYDPSHPDANAQGYVAYP
NVNAVVEMADLVEATRAYQANVAAFQSAKNMAQNAIGMLQT
Download sequence
Identical sequences I9X470
WP_000480105.1.72022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]