SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J0IVW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J0IVW0
Domain Number - Region: 28-77
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0696
Family Fibrinogen coiled-coil and central regions 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J0IVW0
Sequence length 88
Comment (tr|J0IVW0|J0IVW0_HELPX) Uncharacterized protein {ECO:0000313|EMBL:EJB29715.1} KW=Complete proteome OX=992024 OS=Helicobacter pylori NQ4200. GN=HPNQ4200_0853 OC=Helicobacteraceae; Helicobacter.
Sequence
MKKIVVSLCVALGFLSADPAQANKAISNADLIKEIRDLKKIISAQNTEINQLRKVQEVLS
GQLGDMRKDILSTRDYCISLRPYIYNWR
Download sequence
Identical sequences J0IVW0
WP_001873253.1.11840 WP_001873253.1.67976 WP_001873253.1.72335 WP_001873253.1.92986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]