SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J0KGD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J0KGD0
Domain Number - Region: 28-77
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0405
Family Fibrinogen coiled-coil and central regions 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J0KGD0
Sequence length 88
Comment (tr|J0KGD0|J0KGD0_HELPX) Uncharacterized protein {ECO:0000313|EMBL:EJB49855.1} KW=Complete proteome OX=992038 OS=Helicobacter pylori Hp H-16. GN=HPHPH16_0010 OC=Helicobacteraceae; Helicobacter.
Sequence
MKKVVVSLCVALGFLSADPAQANKAISNADLIEEIRDLKKIISAQNTEINQLRKVQEVLS
GQLGDMRKDILSTRDYCISLRPYIYNWR
Download sequence
Identical sequences A0A1V3ADF4 I0EHV0 I9Y378 J0DVG8 J0HAK6 J0KGD0 J0L929 J0M734 J0MZT6 J0Q0V5 J0QUZ5 J0RP86 J0SMC9 T2T7W1
gi|386755795|ref|YP_006229012.1| WP_000758351.1.100603 WP_000758351.1.19501 WP_000758351.1.19736 WP_000758351.1.22375 WP_000758351.1.31228 WP_000758351.1.31549 WP_000758351.1.35618 WP_000758351.1.46879 WP_000758351.1.49116 WP_000758351.1.5722 WP_000758351.1.68226 WP_000758351.1.70002 WP_000758351.1.70282 WP_000758351.1.70661 WP_000758351.1.73067 WP_000758351.1.79119 WP_000758351.1.80072 WP_000758351.1.80199 WP_000758351.1.83442 WP_000758351.1.8766 WP_000758351.1.91159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]