SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J0MUF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J0MUF7
Domain Number - Region: 56-125
Classification Level Classification E-value
Superfamily Hsp90 co-chaperone CDC37 0.0366
Family Hsp90 co-chaperone CDC37 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J0MUF7
Sequence length 159
Comment (tr|J0MUF7|J0MUF7_9FLAO) Regulatory protein RecX {ECO:0000256|HAMAP-Rule:MF_01114, ECO:0000256|SAAS:SAAS01000783} KW=Complete proteome OX=1125720 OS=Capnocytophaga sp. oral taxon 335 str. F0486. GN=HMPREF1320_1476 OC=Flavobacteriaceae; Capnocytophaga.
Sequence
MEATAKTYTVQEAKERLEAYCAYQERCHREVIAKLRAMGMIPLAIDDIVVHLIQNDFLNE
ERFAKSFARGKFRIKKWGRVRIERELKTRGLSDYNIEVGLEEIDEEEYIDTFEIVAEKKQ
ATIKEKNPYKAKAKLTNYLLYRGWEPDLVYEKVEELYEK
Download sequence
Identical sequences C7M400 J0MUF7
gi|256819867|ref|YP_003141146.1| WP_009417044.1.29896 WP_009417044.1.37490 521097.Coch_1030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]