SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J0QW82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J0QW82
Domain Number - Region: 9-47
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.00249
Family Fibrinogen coiled-coil and central regions 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J0QW82
Sequence length 72
Comment (tr|J0QW82|J0QW82_9RHIZ) Protein SlyX homolog {ECO:0000256|HAMAP-Rule:MF_00715} KW=Complete proteome; Reference proteome OX=1094558 OS=Bartonella tamiae Th239. GN=ME5_00677 OC=Bartonellaceae; Bartonella.
Sequence
MMYNMVNNERLVELEIKVSEQEKTIDELSSVLAQQWKTIERIEHQLTLLTKRFVHLEEQI
PPDIPITKPPHY
Download sequence
Identical sequences J0QW82
WP_008038432.1.13061 WP_008038432.1.29214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]