SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J0UW51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J0UW51
Domain Number - Region: 52-113
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.00968
Family RecG, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J0UW51
Sequence length 180
Comment (tr|J0UW51|J0UW51_9HELI) Uncharacterized protein {ECO:0000313|EMBL:EJF06062.1} KW=Complete proteome; Reference proteome OX=1177931 OS=Thiovulum sp. ES. GN=ThvES_00018740 OC=Helicobacteraceae; Thiovulum.
Sequence
MEKQTNVYLEIIDRESGKIEERFSNGENLSSDDLHTIALKGQFKHIETLEKSLENIETNF
EEIENHLDNRKNEIVKKFQTLEEKFEGFKASIREDREKKVVEFKSENEKRFREIDSMFSK
IESSNDEKLKDIEIALSRLESKIESGEKEIGKEITNTVKWYIGGIGVILVSLKLLDLLLK
Download sequence
Identical sequences J0UW51

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]