SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J0YP06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J0YP06
Domain Number 1 Region: 3-221
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.94e-55
Family ABC transporter ATPase domain-like 0.00011
Further Details:      
 
Weak hits

Sequence:  J0YP06
Domain Number - Region: 211-271
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.00327
Family Gametocyte protein Pfg27 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J0YP06
Sequence length 302
Comment (tr|J0YP06|J0YP06_9STRE) ABC superfamily ATP binding cassette transporter, ABC protein {ECO:0000313|EMBL:EJG85959.1} KW=Complete proteome; Reference proteome OX=1159208 OS=Streptococcus infantis SPAR10. GN=SPAR10_1558 OC=Streptococcus.
Sequence
MKTVLEIHGLSKQFGKQPILQDLSLSVKEGDVYGLIGKNGAGKTTLIKIITQLLSADHGT
ISLFSSQGYKECTKALSRVGSVIESPVAHNHLTAYQNLRYYCTIRHIPNADQVIQETLKY
VGLTDTGRKVFRDFSLGMKQRLGIAIALLSKPDFLILDEPINGLDPIGIKEFRQMIQRLN
QELDITILISSHILSELYLVANRFGILDQGRIIREISKAEFETLNEDYIVLKTSDKEKAS
QILKDKVHLEFKVVNSDNEIHIFSHEQDVKRILKELTLADVAVDEIYYARQNLEEYFTQL
VK
Download sequence
Identical sequences A0A1N1PIU4 J0YP06
WP_004253672.1.69269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]