SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J3EF16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J3EF16
Domain Number - Region: 30-132
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.000942
Family PA0094-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J3EF16
Sequence length 157
Comment (tr|J3EF16|J3EF16_9ACTO) Uncharacterized protein {ECO:0000313|EMBL:EJN45309.1} KW=Complete proteome OX=1105029 OS=Actinomyces sp. ICM39. GN=HMPREF1137_0832 OC=Actinomyces.
Sequence
MTLASGWRFLTPEEYAQLGPLADDPSVRLVAVAKTKDEGNVPTFVVTGGALNTDASDDEV
YADSVRQVEEALPGFHLIDDFAWPVAPHGARWRTGVYILENVSLTLSQLTWITRTAPATQ
QSPQRFLWTATCTCPSVLFPTVIDDFITMAQTLEVTP
Download sequence
Identical sequences A0A2I1HY42 J3EF16
WP_009054008.1.33177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]