SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J3LAI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J3LAI7
Domain Number - Region: 76-94,137-145
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.011
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J3LAI7
Sequence length 152
Comment (tr|J3LAI7|J3LAI7_ORYBR) Uncharacterized protein {ECO:0000313|EnsemblPlants:OB02G16540.1} KW=Complete proteome; Reference proteome OX=4533 OS=Oryza brachyantha (malo sina). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MVARHAEPLTEQQAAGVYGVQQWAREREEALDRDLDATHRALSDAVSSDALPPPCPPAAA
FSDVAMAHLSLAVANLTSLEAFVRQADALRLQTLYKLPQILTARQSARCFLAIADHSHRL
RALTSLWLSRPRHPDQPPPPPPPPPAAGRLHP
Download sequence
Identical sequences J3LAI7
OB02G16540.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]