SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J5N4Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J5N4Q2
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily YfbU-like 1.57e-27
Family YfbU-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J5N4Q2
Sequence length 78
Comment (tr|J5N4Q2|J5N4Q2_PASMD) Uncharacterized protein {ECO:0000313|EMBL:EJS87542.1} KW=Complete proteome; Reference proteome OX=1032867 OS=Pasteurella multocida subsp. multocida str. Anand1_cattle. GN=AAUPMC_15635 OC=Pasteurellaceae; Pasteurella.
Sequence
MEMTSTQRLILANQYKLMGLLDSQNAQKYQRLEAIVKGGFALELKELDKEFSDVSEQECK
TVLDTLEMYNALQTSYNN
Download sequence
Identical sequences J5N4Q2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]