SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J6EDV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J6EDV1
Domain Number 1 Region: 2-30
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 0.0000000000000085
Family Proteinase A inhibitor IA3 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J6EDV1
Sequence length 69
Comment (tr|J6EDV1|J6EDV1_SACK1) PAI3-like protein {ECO:0000313|EMBL:EJT41837.1} KW=Complete proteome; Reference proteome OX=226230 OS=8840 / NBRC 1802 / NCYC 2889) (Yeast). GN=SKUD_186002 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MNTDQQKVNEIFQSSKEKLQGDAKVVNDAFKEMASKDKNGKDDNISDNTRKPDYQEQYNK
LKGAGHRNE
Download sequence
Identical sequences J6EDV1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]