SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J6L8F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J6L8F3
Domain Number - Region: 10-108
Classification Level Classification E-value
Superfamily Bacterial luciferase-like 0.000673
Family Non-fluorescent flavoprotein (luxF, FP390) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J6L8F3
Sequence length 125
Comment (tr|J6L8F3|J6L8F3_9RHOB) Transposase {ECO:0000313|EMBL:EJW09783.1} KW=Complete proteome; Reference proteome OX=1187851 OS=Rhodovulum sp. PH10. GN=A33M_0959 OC=Rhodobacteraceae; Rhodovulum.
Sequence
MRVERARLSRHAPVAKAMDYLLTRWESFARFLHDGRICLTNNAAERALRGFALGRKTWLF
AGSDRGADRAAAMATLIMTAKLNDVDPQAWLADVLARIADTRQSRLDELLAWNWKAADEP
LALAS
Download sequence
Identical sequences J6L8F3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]