SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J7HZ65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J7HZ65
Domain Number 1 Region: 21-98
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 1.01e-22
Family Chemosensory protein Csp2 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J7HZ65
Sequence length 104
Comment (tr|J7HZ65|J7HZ65_APICC) Chemosensory protein {ECO:0000313|EMBL:AFQ07770.1} OX=94128 OS=Apis cerana cerana (Oriental honeybee). GN=CSP5 OC=Apoidea; Apidae; Apis.
Sequence
MKIKILLFFTILALINVKAQNDISKFLMDRPYVQKQLHCILDRGHCDVIGKKIKELLPEV
LNNHCNRCTSRQVGIANTLIPFMQQNYPYEWQLILRRYKIMKYY
Download sequence
Identical sequences J7HZ65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]