SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J7S6B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J7S6B0
Domain Number - Region: 15-60
Classification Level Classification E-value
Superfamily Fibritin 0.0224
Family Fibritin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J7S6B0
Sequence length 76
Comment (tr|J7S6B0|J7S6B0_KAZNA) Uncharacterized protein {ECO:0000313|EMBL:CCK69646.1} KW=Complete proteome; Reference proteome OX=1071383 OS=(Saccharomyces naganishii). GN=KNAG_0C05480 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kazachstania.
Sequence
MENPYDKVQSNILSRIIANVERLNQSVVTLNQELATVTQKNKQLETIGTICENYSSSMQF
NLETTGHMRPPNGDAD
Download sequence
Identical sequences J7S6B0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]