SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J7S721 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J7S721
Domain Number - Region: 53-122
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.017
Family MukF C-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J7S721
Sequence length 170
Comment (tr|J7S721|J7S721_KAZNA) Uncharacterized protein {ECO:0000313|EMBL:CCK70724.1} KW=Complete proteome; Reference proteome OX=1071383 OS=(Saccharomyces naganishii). GN=KNAG_0F00550 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kazachstania.
Sequence
MEFDELLNLEEKFYQEGLEEGQNENLKNNFLEGKQFGLQVGFQRYVLLGQMLGLCGMFES
LELGNAMLDKNINTIRSLICTIEMNNDEENVENLEKVLVKLKNKFRTILLSVQRLVKEKN
KTTGNEQNGKSLNFDDVEKLSRMIAGEMKGFVEDEDVTEAKTTQDQANDW
Download sequence
Identical sequences J7S721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]