SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J7S7T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J7S7T9
Domain Number - Region: 74-98
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 0.0445
Family Proteinase A inhibitor IA3 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J7S7T9
Sequence length 119
Comment (tr|J7S7T9|J7S7T9_KAZNA) Uncharacterized protein {ECO:0000313|EMBL:CCK70486.1} KW=Complete proteome; Reference proteome OX=1071383 OS=(Saccharomyces naganishii). GN=KNAG_0E02250 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kazachstania.
Sequence
MASFFVQLWDSIFQPGTTPQLVIATHASFTALLLTLGWLIYVTQGNIHFIMLALIASLLW
AAVGWFIVELSRADLKKNEELTQESKESLTGDGKTTSESATATGQKLPSQKNSTRSRKL
Download sequence
Identical sequences J7S7T9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]