SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J8H6T2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J8H6T2
Domain Number - Region: 59-153
Classification Level Classification E-value
Superfamily IpaD-like 0.0602
Family IpaD-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J8H6T2
Sequence length 175
Comment (tr|J8H6T2|J8H6T2_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EJR21600.1} KW=Complete proteome OX=1053222 OS=Bacillus cereus MSX-D12. GN=II9_00553 OC=Bacillus cereus group.
Sequence
MKRLSYFLVFIFICLVGAGCAKDKEGEKLEYNGRALVIGVVGEKPKDTFRNVKFEEIKLE
ELEKKSKEVDGFLIMKDHFQEASTEQYKNVFSSLKKPVFFIGLQDKSYSIFITKGIEYNS
ARKDVNAMYTQGFANIGSGEGQQWAVGLSNGGNTEESIHNMYIVVFQTIADYLNR
Download sequence
Identical sequences A0A1J9ZCP8 A0A243IA05 A0A2A7LQT1 A0A2K1RRN3 C2MSS9 J8H6T2 J8J1L3
WP_000826892.1.100873 WP_000826892.1.101843 WP_000826892.1.11044 WP_000826892.1.16199 WP_000826892.1.17899 WP_000826892.1.24709 WP_000826892.1.38425 WP_000826892.1.41976 WP_000826892.1.43533 WP_000826892.1.46244 WP_000826892.1.47441 WP_000826892.1.48010 WP_000826892.1.49056 WP_000826892.1.5628 WP_000826892.1.57245 WP_000826892.1.57565 WP_000826892.1.58037 WP_000826892.1.61231 WP_000826892.1.79250 WP_000826892.1.80955 WP_000826892.1.82421 WP_000826892.1.91080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]