SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J8K0X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J8K0X1
Domain Number - Region: 35-60
Classification Level Classification E-value
Superfamily IpaD-like 0.0129
Family IpaD-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J8K0X1
Sequence length 64
Comment (tr|J8K0X1|J8K0X1_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EJR56740.1} KW=Complete proteome OX=1053230 OS=Bacillus cereus VD115. GN=IIO_05270 OC=Bacillus cereus group.
Sequence
MCALCRNTGIIRKEIYPGVGLTEGCNCEVAKQQQQENDKRWEAWLIKFESMKQELQRNQQ
QKVS
Download sequence
Identical sequences J8K0X1
WP_000332465.1.100095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]