SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J8Q6F5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J8Q6F5
Domain Number 1 Region: 2-30
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 0.00000000000000209
Family Proteinase A inhibitor IA3 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J8Q6F5
Sequence length 68
Comment (tr|J8Q6F5|J8Q6F5_SACAR) Pai3p {ECO:0000313|EMBL:EJS44196.1} KW=Complete proteome; Reference proteome OX=1160507 OS=Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644) (Yeast). GN=SU7_0692 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MNTDQQKVSDIFQSSKEKLQGDAKVVSDAFKEMAKKDKGGKADNISDKDKPDYQEQYNKL
KQSAHKKE
Download sequence
Identical sequences J8Q6F5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]