SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J8WUD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J8WUD7
Domain Number - Region: 98-144
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 0.0837
Family Ecotin, trypsin inhibitor 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J8WUD7
Sequence length 179
Comment (tr|J8WUD7|J8WUD7_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EJV59193.1} KW=Complete proteome OX=1053193 OS=Bacillus cereus BAG6O-2. GN=IEM_04376 OC=Bacillus cereus group.
Sequence
MLRKKLRIIILLVLVVGIGVIGYRLLGPFIDGRSYYYSHTAFTDLSNESIGKMKLHDNIS
KDSFRERYGEPISKQENVLYDYYSWKNGVETASIMEGKEKGKIVRLIIGENTDLKTAKGI
GLGSTKQDVINSYGSNYYERTEQGTTIIGYADHKLHTTIEFWLGEGKVAHIRLDDADVE
Download sequence
Identical sequences J8WUD7
WP_002202944.1.53916 WP_002202944.1.75300 WP_002202944.1.89263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]