SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9BHV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9BHV0
Domain Number 1 Region: 62-224
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.48e-52
Family Motor proteins 0.00000458
Further Details:      
 
Weak hits

Sequence:  J9BHV0
Domain Number - Region: 38-72
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.000523
Family Myosin S1 fragment, N-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9BHV0
Sequence length 242
Comment (tr|J9BHV0|J9BHV0_WUCBA) Myosin {ECO:0000313|EMBL:EJW86925.1} KW=Complete proteome; Reference proteome OX=6293 OS=Wuchereria bancrofti. GN=WUBG_02163 OC=Spiruromorpha; Filarioidea; Onchocercidae; Wuchereria.
Sequence
MAAAEENAELCKFEDDDGYPYLEVSREERSTNAAKPFDSKKNCWIPDADDGFIAAEIKSS
AGDNVTVVTVKGNEITMKKEEVQEMNPPKFRKTDDMANLTFLNEASTYSGLFCVVINPYK
RLPIYSPSIIKHYMGKRRNEMPPHLFAVSDEAYRNILVDHENQSMLITGESGAGKTENTK
KVITYFAIVGATQQKKDESKKGGTLEEQIVQTNPVLEAFGNAKNGSKQQFFTIRQIHPNS
FH
Download sequence
Identical sequences J9BHV0
WUBG_02163T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]