SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9DUQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J9DUQ7
Domain Number - Region: 35-85
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0968
Family Clostridium neurotoxins, "coiled-coil" domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9DUQ7
Sequence length 107
Comment (tr|J9DUQ7|J9DUQ7_EDHAE) Uncharacterized protein {ECO:0000313|EMBL:EJW05027.1} KW=Complete proteome; Reference proteome OX=1003232 OS=Edhazardia aedis (strain USNM 41457) (Microsporidian parasite). GN=EDEG_00880 OC=Eukaryota; Fungi; Microsporidia; Edhazardia.
Sequence
MILIFPLIHIKKIEFESWRIFDQKVIGISNQEKFKKLLKYCLKVKIYVLNNHFNINFSGQ
SVVSQTSPFNLHYFLFDYLSKRSIDPKIFTSLKKYFEKVQKIFSLIS
Download sequence
Identical sequences J9DUQ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]