SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9EKG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9EKG5
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 1.46e-26
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9EKG5
Sequence length 75
Comment (tr|J9EKG5|J9EKG5_WUCBA) Signal recognition particle 9 kDa protein {ECO:0000256|PIRNR:PIRNR017029} KW=Complete proteome; Reference proteome OX=6293 OS=Wuchereria bancrofti. GN=WUBG_06133 OC=Spiruromorpha; Filarioidea; Onchocercidae; Wuchereria.
Sequence
MYFTNWEEFSKAVDRLYTSNPTRCRFVTKYNHKKGKMTLKMTDDVVCLQYDTDQIQDVKR
LEKLTATLMRHIVSK
Download sequence
Identical sequences A0A044UU30 A0A0K0JSL4 A0A0N4T500 A0A182E819 J9EKG5
WUBG_06133T0 Bm7482 XP_001892776.1.25112 OVOC7766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]