SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9ENG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J9ENG2
Domain Number - Region: 33-49
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0785
Family Somatomedin B domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9ENG2
Sequence length 49
Comment (tr|J9ENG2|J9ENG2_WUCBA) Uncharacterized protein {ECO:0000313|EMBL:EJW78547.1} KW=Complete proteome; Reference proteome OX=6293 OS=Wuchereria bancrofti. GN=WUBG_10545 OC=Spiruromorpha; Filarioidea; Onchocercidae; Wuchereria.
Sequence
FYWVVNLYGRVEYEDRQSADYVDTVLYKSSLFTFCFHLCFVLLKCCWWY
Download sequence
Identical sequences J9ENG2
WUBG_10545T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]