SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9PBM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9PBM2
Domain Number 1 Region: 32-80
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.0000000000000144
Family Cysteine-rich DNA binding domain, (DM domain) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9PBM2
Sequence length 255
Comment (tr|J9PBM2|J9PBM2_CANLF) Uncharacterized protein {ECO:0000313|Ensembl:ENSCAFP00000043203} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=LOC100688890 OC=Canis.
Sequence
MDPNEMPAVPCCPSDSPTGLETGAPWGIELGPKRAVSRCVHCYNHGFTEQIKDQEHFCPF
QACDCHKCAFFSEHRSVLPAESALNKEQGAHLKRHLAQGLTRSGASLPKAHGHVTKLTIQ
AGVISKHPRSSADWSGPKTFVSILDSSSLEDATNNFCFEEDPQDPCPAQPAPEASDQDLV
SASEWQRKLEAAEALLILRDSTQESSGSIFLLQPCVAAAPAGDTGLQPPSPSLRPRPATT
ISLPIGHLGCISLLS
Download sequence
Identical sequences J9PBM2
ENSCAFP00000043203 ENSCAFP00000043203 XP_005641554.1.84170 XP_005641556.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]