SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9VRX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9VRX5
Domain Number 1 Region: 21-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000021
Family Glutathione S-transferase (GST), N-terminal domain 0.014
Further Details:      
 
Weak hits

Sequence:  J9VRX5
Domain Number - Region: 160-242
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000681
Family Glutathione S-transferase (GST), C-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9VRX5
Sequence length 252
Comment (tr|J9VRX5|J9VRX5_CRYNH) Uncharacterized protein {ECO:0000313|EMBL:AFR97227.1} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_04508 OC=Cryptococcus neoformans species complex.
Sequence
MAKYTLYQLIGKSEHTDGRVISPHVWKTKLDLAYFGQEVKAEGKTFPQIRGELAETTKNS
AVTVPTIVDEEGLVITDSWKIAEYLEAKHGSAEKSVFGGQVGKEFAKFIEIWSNATLANE
FRPLIASAIFELFDEPSKNYFIKSKFGGDLSRFEAHKSKFSDPSNINAQLTAARTRLTVI
ETLLGYKKEKAEPLWLSGKPSHADFCLFGWYAASRINPAVERGVWRHEENPLVGEWLDLI
LRSGLVDQAQFD
Download sequence
Identical sequences J9VRX5
CNAG_04508T0 XP_012051845.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]