SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K1QXB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K1QXB4
Domain Number 1 Region: 5-41
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.000000147
Family Huristasin-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K1QXB4
Sequence length 118
Comment (tr|K1QXB4|K1QXB4_CRAGI) Uncharacterized protein {ECO:0000313|EMBL:EKC35814.1} KW=Complete proteome; Reference proteome OX=29159 OS=Crassostrea gigas (Pacific oyster) (Crassostrea angulata). GN=CGI_10019084 OC=Ostreoida; Ostreoidea; Ostreidae; Crassostrea.
Sequence
MSSAPGYQSDELTCQEVCKTKCEHGYVYDKDGCKTCKCKPKDSMQPGQKSHSLEEGGGRQ
TPKENFPGKQDYLKRKCKAVDPDKAQETAPNHGRAGPSTTTDLEDVVVIHGREDDSGV
Download sequence
Identical sequences K1QXB4
EKC35814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]