SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K2FIA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K2FIA1
Domain Number - Region: 63-123
Classification Level Classification E-value
Superfamily RGC domain-like 0.0183
Family RGC domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K2FIA1
Sequence length 128
Comment (tr|K2FIA1|K2FIA1_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:EKE10560.1} OX=717931 OS=groundwater metagenome. GN=ACD_16C00005G0001 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MNPHTFLRLFKREDKEPRNIISLRRKTIERNFGSYFQLRIPRSLKGERGVERVSQTIRNI
LLQNGQPSDILRTIQFRGRSGFLIIEIWRGDHFLDDLELNFSDLKHENVYYYEVLGLLAN
CQLIVFGQ
Download sequence
Identical sequences K2FIA1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]