SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WHP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WHP6
Domain Number 1 Region: 242-390
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0072
Further Details:      
 
Domain Number 2 Region: 366-482
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.75e-23
Family Ypt/Rab-GAP domain of gyp1p 0.015
Further Details:      
 
Domain Number 3 Region: 13-138
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.68e-16
Family Calponin-homology domain, CH-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3WHP6
Sequence length 1198
Comment (tr|K3WHP6|K3WHP6_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T004488} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MLVPPKATSSGEIAQRWMEMVLGEKFQSEFTVVLRSGVALCDLANRVFKALGMKDKVVAF
DEHASDDGEMDGGIDAMVYVSNRPPRGATQNIRAYLSACELLGVSAEDMFEPDDLLQYRN
IDKVYRNILALQIVAVSLSTRRSIDDRSSLGAKPIFSPISDPGGITFLHDDGVDSPSLID
LVQHQSWPQLLFEYEYQQLKQEEQNKSNDPSATEGLGKLAHDIWGTEERIRALLMNEDHE
LGLVPDDLHGKLWMLASGAELEMRRHKGQYQRLVDMEAESTEATRQIDVDLYRTVSKTDK
TLWNEDKTQQMRRVLVAYSYYNPTLGYCQGLNYIVARILLFLDEEEAFYLLIKMIRLVPE
DYYTSMLGLAVDQHVFTDLVRIQTPDITEHLTDLGGSGVELSLACTEWFLTLFASPCDKE
VTVRIWDSIFLLGDEMLFRVALALMQLEKSTLINCKNYGDMLKHLNEIGRENTDASDLLR
LSRDQDCVYRARIEDFRAHHRLQLASGIVASAVESEDATVTSSTGRPSTENKAESRIRQI
GKAAKRHSIFKHLDRNAGRESKTFDRYITDDFSAMLQKEHPNFACYYDGAPPMVFDRYWG
SKESYNQWGTRHVKHIALGPEEDLGLERWRLQSDAPSFHTNRRLATSSVSEIPIPGRGLP
RERRSKSTAFIQTKKSGQGTPGSSGVTHTLSQSGTNEDVSQYGRSPRTWIQKIEDWHKEM
KIQKEKKKAEKKLRQGQRSDSVFSSSATRGSQMSQLDERGSSTVRRHRKSFSSSPPRSHH
KGGLRDTASMENLHSPVDRLASSVGPRKKGKDLSEVPLARSFSDPFHSPNGVLHGRSPWQ
QQQQKKPSRRDIQAEIDAQIVMRSQDPYNEDFKRGDDERISDYGAERGRSRREQSSHNRA
SNGSNGAAHRHSDYSATSRASIQSSTSSISYAPVPASAAARSTTTEEKMLQRRRSNNDIR
RPPLQHPKASSSNSSYSKVPPPPPSESEYSVSPVFSQLRNSNSNSTTYQDEEYDAMKSPY
MQPIMRRNMSMPAVENLQPSGSASHKWMLRTVGTKRPPTAADSARVIRDRAHVVSYLQRK
LSDASSLAGSISRSPRGDRMDVTRLSGSSSGSSRTSDIFGSNRSAVLTKPYRKGSFSFFD
KLSSDLESCLDDLNTSYLDDSDLASDVGSSTLPLPTKNGGASALDEWRRRSSFAAYRS
Download sequence
Identical sequences K3WHP6
PYU1_T004488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]