SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4K7X4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K4K7X4
Domain Number - Region: 85-141
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.00876
Family F1F0 ATP synthase subunit B, membrane domain 0.011
Further Details:      
 
Domain Number - Region: 58-91
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.0732
Family Staphylocoagulase 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K4K7X4
Sequence length 184
Comment (tr|K4K7X4|K4K7X4_9MARC) ATPase subunit I {ECO:0000256|HAMAP-Rule:MF_01398} OX=304445 OS=Apopellia endiviifolia. GN=atpF OC=Jungermanniopsida; Pelliidae; Pelliales; Pelliaceae; Apopellia.
Sequence
MENGTDLVFSRKFWTLANSFGINTNLLETNLINLGVVLSLLVYFGKGVLSNLLKNRRLTI
LNTIRDADERYKEATDKLKQAIIRLQQAKIKADDIRINGLSQMEREKQDLIDAADGDSKR
LEDSKNATIRFEKQRAIEQVRQQVSCLALERALETLKNRLNSELHLRMIDHNIGLLKAME
STVE
Download sequence
Identical sequences K4K7X4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]