SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K5WGD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K5WGD7
Domain Number - Region: 106-184
Classification Level Classification E-value
Superfamily IpaD-like 0.0523
Family IpaD-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K5WGD7
Sequence length 191
Comment (tr|K5WGD7|K5WGD7_AGABU) Uncharacterized protein {ECO:0000313|EMBL:EKM74336.1} KW=Complete proteome; Reference proteome OX=597362 OS=FGSC 10392) (White button mushroom). GN=AGABI1DRAFT_133383 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Agaricaceae; Agaricus.
Sequence
MVFSDHVFTPGDYEFWKQRSQSILDSKRGRAAVLHGGYVWRLALAAGHGVSEALKGPSGL
HPRDYLNFCAWDKDGVEYVDDDLTKDELDLMCGVYQSFTGTGTNIKKQSWYPLVSTFEGS
GEDQGRWYYRLEQNYKNRESSILGEKVTVNSRLLLSATQWRDKVRGFGEARRATASVEKW
STRFIDTYCPL
Download sequence
Identical sequences K5WGD7
XP_007335023.1.70068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]