SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7ETY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7ETY5
Domain Number 1 Region: 1069-1114
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000353
Family Nuclear receptor coactivator interlocking domain 0.00052
Further Details:      
 
Domain Number 2 Region: 123-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000017
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.03
Further Details:      
 
Domain Number 3 Region: 268-372
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000306
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00055
Further Details:      
 
Domain Number 4 Region: 32-92
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000055
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7ETY5
Sequence length 1464
Comment (tr|K7ETY5|K7ETY5_PONAB) Nuclear receptor coactivator {ECO:0000256|PIRNR:PIRNR038181} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0020747 OC=Catarrhini; Hominidae; Pongo.
Sequence
MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAELIFANFNDI
DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
EALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSI
VNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKYETMQCFAVSQPKSIKE
EGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
RRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT
TNEPQLVISLHMLHREQNVCVMNPDLTGQTMGKPLNPISSNSPAHQALCSGNPGQDMTLS
SNINFPINGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPG
QPTSMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQAL
SEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQA
ESSCHPGEQKETNDPNLPPAVSSERADGQSRLHDSKGQTKLLQLLTTKSDQMEPSPLASS
LSDTNKDSTGSLPGSGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKDLSQESS
STAPGSEVTIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTK
LIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAII
NDLMQLTAENSPVTPIGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAG
PFPPIRNSSPYSVIPQPGMMGNQGMIGNQGNLGNSSTGMIGSSASRPTMPSGEWAPQSSA
VRVTCAATTSAMNRPVQGGMIRNPAASIPMRPSSQPGQRQTLQSQVMNIGPSELEMNMGG
PQYSQQQAPPNQTAPWPESILPIDQASFAGQNRQPFGSSPDDLLCPHPAAESPSDEGALL
DQLYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFSSQDSNIMLEQKAPVFPQQYASQ
AQMAQGSYSPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLRLQLQHRLQAQ
QNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQ
RTLMMRGQGLNMTPSMVAPSGMPATMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATT
PQSPLMSPRMAHTQSPMMQQSQANPAYQAPSDMNGWAQGNMGGNSMFSQQSPPHFGQQAN
TSMYSNNMNINVSMATNTGGMSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGG
NLFPNQLPGMDMIKQEGDTTRKYC
Download sequence
Identical sequences K7ETY5
ENSPPYP00000024008 XP_002819216.1.23681 XP_009242134.1.23681 ENSPPYP00000024008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]