SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FK91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FK91
Domain Number 1 Region: 37-117
Classification Level Classification E-value
Superfamily TRAF domain-like 1.8e-22
Family MATH domain 0.0000698
Further Details:      
 
Weak hits

Sequence:  K7FK91
Domain Number - Region: 5-36
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0994
Family Trimerization domain of TRAF 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7FK91
Sequence length 118
Comment (tr|K7FK91|K7FK91_PELSI) Uncharacterized protein {ECO:0000313|Ensembl:ENSPSIP00000008451} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN= OC=Pelodiscus.
Sequence
ILQQEEKVAHQDSLLALKDVMISSLGARIQVLEQVSYDGRFLWRVSDVGQRMQQARSGQI
PALYSPPLSLSSAYGYKLCLKVYLNGDGSGARTHISLFLVVMKGEYDFQLKWPFQHKV
Download sequence
Identical sequences K7FK91
ENSPSIP00000008451 ENSPSIP00000008451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]