SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FLH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FLH6
Domain Number 1 Region: 49-97
Classification Level Classification E-value
Superfamily GLA-domain 4.37e-20
Family GLA-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7FLH6
Sequence length 220
Comment (tr|K7FLH6|K7FLH6_PELSI) Proline rich and Gla domain 4 {ECO:0000313|Ensembl:ENSPSIP00000008886} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=PRRG4 OC=Pelodiscus.
Sequence
MSVVLVLLCQLPVMFAFPHCIRRLKHTRKQVFMSEKGANLFIGRHLLYNRFDFEAFTPGN
LERECYEETCNYEEAREIFEDPAKTMNFWKEYSIKGPGTKTDGETLQKIDVTGLLTGLVA
VGVVLVITGLLIYYFCKNRCKPRQQSGYSDSVRSRRSSSIFRRHDEVSLNPLPLRTNESG
LPTYEEAVTLGGKYDAPPPPYPGPAKELKVLKKSVSLPAP
Download sequence
Identical sequences K7FLH6
XP_006110337.1.96668 ENSPSIP00000008886 ENSPSIP00000008886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]