SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FQE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FQE8
Domain Number 1 Region: 658-936
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.99e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000675
Further Details:      
 
Domain Number 2 Region: 235-381
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-39
Family Third domain of FERM 0.00013
Further Details:      
 
Domain Number 3 Region: 133-237
Classification Level Classification E-value
Superfamily Second domain of FERM 9.68e-36
Family Second domain of FERM 0.0000793
Further Details:      
 
Domain Number 4 Region: 49-131
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.44e-23
Family First domain of FERM 0.001
Further Details:      
 
Domain Number 5 Region: 533-627
Classification Level Classification E-value
Superfamily PDZ domain-like 9.32e-21
Family PDZ domain 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7FQE8
Sequence length 949
Comment (tr|K7FQE8|K7FQE8_PELSI) Tyrosine-protein phosphatase {ECO:0000256|PIRNR:PIRNR000927} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=PTPN4 OC=Pelodiscus.
Sequence
MDLILKTVLVPRCTDLVWTVMTARFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTV
QAFRVNKHDQGQVLLDIVFKHLDLTERDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSP
YSLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILTGRLPCPYNTAALLASYSVQSELGD
YSHSENLPGYLSDYSFIPSQPQDFEKEIAKLHHQHIGLSPAEAEFSYLNTARTLELYGVE
LHYARDQSNNEIMIGVMSGGILIYKNRVRINTFLWLKIVKISFKCKQFFIQLRKELHESR
EMLLGFNMVNYRACKNLWKACVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQ
SVQYGKEKANKDRVFARSPSKPLARKLMSGMDWEVVSRNSLTDDRLETQSLPSRSPPGTP
NHRNSAFTQERARLRPSSVGHLVDHVVHTSPSEVFANHRSPSSTQANSIILESSPSQETP
IDGQPPALPPKQSKKNSWNQIHYSHSQQELDNHINETFDVSSSPEKSTPNGGVPPDNLVL
IRMKPDENGRFGFNVKGGSDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEH
THDEVVMFIKESCERHSGELVLLVRPNAVYDVVEEKLESEPDFQYIPEKSPLDAVHQDDN
ALRESMIQLSEGLITGTILAQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVI
LKSNDDYINANYINMEIPSSSIINQYIACQGPLPNTCPDFWQMTWEQGSSMVVMLTTQVE
RGRVKCHQYWPEPTGSSSYGNFQIACHSEEGNPAYVFREMTLTNLEKNETRQLTQIQYVA
WPDHGVPDDSSDFLDFVCLVRKKRAGREEPVVVHCSAGIGRTGVLITMETAMCLIECNQP
VYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYEEGFVKPLKTSLHK
Download sequence
Identical sequences K7FQE8
XP_006137781.1.96668 ENSPSIP00000010258 ENSPSIP00000010258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]