SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7G5H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7G5H3
Domain Number 1 Region: 1-138
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 5.62e-45
Family Hypothetical protein c14orf129, hspc210 0.000000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7G5H3
Sequence length 139
Comment (tr|K7G5H3|K7G5H3_PELSI) GSK3B interacting protein {ECO:0000313|Ensembl:ENSPSIP00000015534} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=GSKIP OC=Pelodiscus.
Sequence
METDYNPMEFSTNPAFEEDSECKDIEGTDVKDMRLEAEAVVNDVLFAVSNMFVSKNLHCA
EDVAYINVETRERNRYCLELTEAGLRVVGYAFDQADDGLQMPYHETVYSLLDSLSPAYRE
AFGNALLQRLEALKRDGQS
Download sequence
Identical sequences K7G5H3
ENSPSIP00000015534 XP_006133773.1.96668 XP_006133774.1.96668 ENSPSIP00000015534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]