SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7H0M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K7H0M2
Domain Number - Region: 10-50
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0199
Family Huristasin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7H0M2
Sequence length 183
Comment (tr|K7H0M2|K7H0M2_CAEJA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:CJA08162a} KW=Complete proteome; Reference proteome OX=281687 OS=Caenorhabditis japonica. GN= OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MGSLIPSFYDFDQINQYYQCYDACQRAYPVAVCANGGVPNPNNCQVCNCPMGYGGDLCDQ
RPNDCGITLLTSNEWKKQRLTVKFNKKDAEYFTFCTSWIMGPANRSLQVTYEITSESVGQ
EICSYGCYLGGIEVKYMKDPRMTNDGDCCMNTPLNVTTTVNPLPVILYTDGTTLNYEISY
RYI
Download sequence
Identical sequences K7H0M2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]