SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7J5P7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7J5P7
Domain Number 1 Region: 87-135
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000144
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 2 Region: 59-86
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000471
Family Somatomedin B domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7J5P7
Sequence length 184
Comment (tr|K7J5P7|K7J5P7_NASVI) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:NV16695-PA} KW=Complete proteome; Reference proteome OX=7425 OS=Nasonia vitripennis (Parasitic wasp). GN= OC=Chalcidoidea; Pteromalidae; Pteromalinae; Nasonia.
Sequence
MKALASNWAVMATVLINFWLFVGPASAGSCGAAKLCCQGRDSGCVIQKASPNAIIESPRD
KPCYCDHACLRLGDCCDDFNETCAVTDCSVSEWSEWSECDNMCGLGLQTRRRHVVRAERN
GGKACPTSLEQTLTCQNYGSCRRRARHFQVEELGPEAAANLSSFTTDSSEATLDSNFVPQ
ITRG
Download sequence
Identical sequences K7J5P7
7425.XP_001604663 gi|156555115|ref|XP_001604663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]